H00002694-M03

CBLIF antibody from Abnova Corporation
GIF, IF, IFMH, INF, TCN3

Antibody data

Product number
H00002694-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002694-M03, RRID:AB_1137229
Product name
GIF monoclonal antibody (M03), clone 1D9
Provider product page
Abnova Corporation - H00002694-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GIF.
Antigen sequence
INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQR
KNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQ
FLSGVTPLNEGVADYIPFNHEHITANFTQY
Isotype
IgG
Antibody clone number
1D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -