HPA012616

HHIP antibody from MilliporeSigma / Merck KGaA
FLJ20992, HIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012616
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA012616, RRID:AB_1850687
Product name
Anti-HHIP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA012616
Antibody type
Polyclonal
Antigen
Hedgehog-interacting protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYS
IPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPT
DININLTILCSDSNGKNRSSARILQIIKGKDYESE
PSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFG
DRNGNFLT
Storage
-20C
Provider Type Product Number
- No reagents -