HPA014429

TAC1 antibody from Sigma-Aldrich
NKNA, NPK, TAC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014429
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014429, RRID:AB_1857722
Product name
Anti-TAC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014429
Antibody type
Polyclonal
Antigen
Protachykinin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFF
GLMGKRDADSSIEKQVALLKALYGHGQISHKRHKT
DSFVGLMGKRALNSVAYERSAMQNYERRR
Storage
-20C
Provider Type Product Number
- No reagents -