AV47958
antibody from MilliporeSigma / Merck KGaA
Targeting: OOSP2
FLJ36198, OOSP2A, PLAC1L, TMEM122
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AV47958 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-PLAC1L antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- synthetic peptide corresponding to a region of human PLAC1L with an internal ID of S20303
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
LVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQ
EIHLECSTSRKSVWL- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data