HPA026786

ITGAD antibody from MilliporeSigma / Merck KGaA
ADB2, CD11d
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026786
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026786, RRID:AB_10603773
Product name
Anti-ITGAD antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026786
Antibody type
Polyclonal
Antigen
integrin, alpha D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSS
VRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLG
IHCETLKLLLPDCVEDVVSPIILHLNFSLV
Storage
-20C
Provider Type Product Number
- No reagents -