Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109609 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-IKAROS Family Zinc Finger 4 (Eos) (IKZF4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNFN1A4 antibody: synthetic peptide directed towards the N terminal of human ZNFN1A4
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
NSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDS
LSEPLGYCDGSGPEP- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The Ikaros family protein Eos associates with C-terminal-binding protein corepressors.
Perdomo J, Crossley M
European journal of biochemistry / FEBS 2002 Dec;269(23):5885-92
European journal of biochemistry / FEBS 2002 Dec;269(23):5885-92
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; WB Suggested Anti-ZNFN1A4 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate; ZNFN1A4 antibody - N-terminal region (AP42188PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Lung; . Rabbit Anti-IKZF4 Antibody. . ARP33275 . Paraffin Embedded Tissue: Human alveolar cell . Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X