Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449872 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-IKAROS Family Zinc Finger 4 (Eos) (IKZF4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the N-terminal region of human IKZF4
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIME
SLFCESSGDSSLEKE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The Ikaros family protein Eos associates with C-terminal-binding protein corepressors.
Perdomo J, Crossley M
European journal of biochemistry / FEBS 2002 Dec;269(23):5885-92
European journal of biochemistry / FEBS 2002 Dec;269(23):5885-92
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human 721_B; WB Suggested Anti-IKZF4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysate. IKZF4 is supported by BioGPS gene expression data to be expressed in 721_B.; IKZF4 antibody - N-terminal region (AP44463PU-N) in Human 721_B cells using Western Blot