Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504051 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PIN4 antibody: synthetic peptide directed towards the middle region of human PIN4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPV
KTKFG YHIIMVEGRK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The DNA binding parvulin Par17 is targeted to the mitochondrial matrix by a recently evolved prepeptide uniquely present in Hominidae.
Kessler D, Papatheodorou P, Stratmann T, Dian EA, Hartmann-Fatu C, Rassow J, Bayer P, Mueller JW
BMC biology 2007 Sep 17;5:37
BMC biology 2007 Sep 17;5:37
No comments: Submit comment
No validations: Submit validation data