HPA011391

MS4A6A antibody from Sigma-Aldrich
CD20L3, MS4A6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011391
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011391, RRID:AB_10603876
Product name
Anti-MS4A6A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011391
Antibody type
Polyclonal
Antigen
membrane-spanning 4-domains, subfamily A, member 6A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRM
GQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSP
V
Storage
-20C
Provider Type Product Number
- No reagents -