HPA015564

STXBP2 antibody from Sigma-Aldrich
Hunc18b, UNC18B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015564
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015564, RRID:AB_1857626
Product name
Anti-STXBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015564
Antibody type
Polyclonal
Antigen
Syntaxin-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQV
FSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATL
CATLQEYPAIRYRKGPEDTAQLAHAVLAKLN
Storage
-20C
Provider Type Product Number
- No reagents -