Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA050492 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA050492, RRID:AB_2681145
- Product name
- Anti-ERCC6L
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLA
ELGVLKKLCDHPRLLSARACCLLNLGTFSAQDGNE
GEDSPDVDHIDQVTDDTLMEESGKMIFLMDLL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Upregulation of ERCC6L is associated with tumor progression and unfavorable prognosis in hepatocellular carcinoma
Loss of PICH promotes chromosome instability and cell death in triple-negative breast cancer
Yu B, Liang H, Ye Q, Wang Y
Journal of Gastrointestinal Oncology 2020;11(5):1009-1023
Journal of Gastrointestinal Oncology 2020;11(5):1009-1023
Loss of PICH promotes chromosome instability and cell death in triple-negative breast cancer
Huang Y, Li W, Yan W, Wu J, Chen L, Yao X, Gu F, Lv L, Zhao J, Zhao M, Xia T, Han Q, Li T, Ying X, Li T, Xia Q, Li A, Zhang X, Chen Y, Zhou T
Cell Death & Disease 2019;10(6)
Cell Death & Disease 2019;10(6)
No comments: Submit comment
No validations: Submit validation data