HPA015736

CPOX antibody from Sigma-Aldrich
CPO, CPX, HCP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015736, RRID:AB_1847194
Product name
Anti-CPOX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015736
Antibody type
Polyclonal
Antigen
Coproporphyrinogen III oxidase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QALAQVDGGANFSVDRWERKEGGGGISCVLQDGCV
FEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDG
KLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEA
DGNKQWWFGGGCDLTPTYLNQEDAVHFH
Storage
-20C
Provider Type Product Number
- No reagents -