ABIN183132

KCNN1 antibody from antibodies-online
hSK1, KCa2.1
Western blot
Data presented on provider website

Antibody data

Product number
ABIN183132
Provider
antibodies-online
Product name
anti-Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 1 (KCNN1) (C-Term) antibody
Provider product page
antibodies-online - ABIN183132
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNN1 antibody: synthetic peptide directed towards the C terminal of human KCNN1
Description
Protein A purified
Reactivity
Human, Bovine
Host
Rabbit
Antigen sequence
KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQH
EELEA RLATLESRLD
Epitope
C-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.