Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183132 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 1 (KCNN1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNN1 antibody: synthetic peptide directed towards the C terminal of human KCNN1
- Description
- Protein A purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
- KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQH
 EELEA RLATLESRLD
- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		The influence of the thickness of non-piezoelectric pieces on pre-stressed piezotransducers.
				
Decreased potassium channel IK1 and its regulator neurotrophin-3 (NT-3) in inflamed human bowel.
				
		
	
			Arnold FJ, Mühlen SS
Ultrasonics 2003 May;41(3):191-6
		Ultrasonics 2003 May;41(3):191-6
Decreased potassium channel IK1 and its regulator neurotrophin-3 (NT-3) in inflamed human bowel.
			Arnold SJ, Facer P, Yiangou Y, Chen MX, Plumpton C, Tate SN, Bountra C, Chan CL, Williams NS, Anand P
Neuroreport 2003 Feb 10;14(2):191-5
		Neuroreport 2003 Feb 10;14(2):191-5
				No comments: Submit comment	
	
			
			No validations: Submit validation data