H00057214-B01P

CEMIP antibody from Abnova Corporation
HYBID, IR2155535, KIAA1199, TMEM2L

Antibody data

Product number
H00057214-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057214-B01P, RRID:AB_1237871
Product name
KIAA1199 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00057214-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KIAA1199 protein.
Antigen sequence
MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAG
CPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSA
TVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGG
ELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGL
KYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAE
GGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTY
RSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLD
DMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSS
SVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSL
SSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAH
PGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRF
ACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN
STILNLEDNVQSWKPGDTLVIASTDYSMYQAEEFQ
VLPCRSCAPNQVKVAGKPMYLHIGEEIDGVDMRAE
VGLLSRNIIVMGEMEDKCYPYRNHICNFFDFDTFG
GHIKFALGFKAAHLEGTELKHMGQQLVGQYPIHFH
LAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGS
NGLLIKDVVGYNSLGHCFFTEDGPEERNTFDHCLG
LLVKSGTLLPSDRDSKMCKMITEDSYPGYIPKPRQ
DCNAVSTFWMANPNNNLINCAAAGSEETGFWFIFH
HVPTGPSVGMYSPGYSEHIPLGKFYNNRAHSNYRA
GMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDA
DPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLDS
CRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVG
ESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPI
RGIQLYDGPINIQNCTFRKFVALEGRHTSALAFRL
NNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWF
NQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDKWH
SLASKAASGPSG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -