Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29502 - Provider product page

- Provider
- Abnova Corporation
- Product name
- PCIF1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- PCIF1 polyclonal antibody raised against recombinant human PCIF1.
- Antigen sequence
SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEI
PVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAA
LLRPTEVYWDLDIQTNAVIKHR- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of U-2 OS cells with PCIF1 polyclonal antibody (Cat# PAB29502) under 1-4 ug/mL working concentration shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with PCIF1 polyclonal antibody (Cat# PAB29502) shows strong nuclear positivity in glandular cells at 1:500 - 1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)