Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001836-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001836-M04, RRID:AB_1137455
- Product name
- SLC26A2 monoclonal antibody (M04), clone 3F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC26A2.
- Antigen sequence
MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRES
STDFKQFETNDQCRPYHRILIERQEKSDTNFKEFV
IKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLK
KNI- Isotype
- IgG
- Antibody clone number
- 3F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epigenetic silencing of the sulfate transporter gene DTDST induces sialyl Lewisx expression and accelerates proliferation of colon cancer cells.
Yusa A, Miyazaki K, Kimura N, Izawa M, Kannagi R
Cancer research 2010 May 15;70(10):4064-73
Cancer research 2010 May 15;70(10):4064-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SLC26A2 expression in transfected 293T cell line by SLC26A2 monoclonal antibody (M04), clone 3F6.Lane 1: SLC26A2 transfected lysate(81.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SLC26A2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol