Antibody data

Product number
H00001836-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001836-M04, RRID:AB_1137455
Product name
SLC26A2 monoclonal antibody (M04), clone 3F6
Provider product page
Abnova Corporation - H00001836-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC26A2.
Antigen sequence
MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRES
STDFKQFETNDQCRPYHRILIERQEKSDTNFKEFV
IKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLK
KNI
Isotype
IgG
Antibody clone number
3F6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -