H00056478-M01

EIF4ENIF1 antibody from Abnova Corporation
2610509L04Rik, 4E-T, Clast4, FLJ21601

Antibody data

Product number
H00056478-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056478-M01, RRID:AB_1137186
Product name
EIF4ENIF1 monoclonal antibody (M01), clone 2C4
Provider product page
Abnova Corporation - H00056478-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EIF4ENIF1.
Antigen sequence
NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVS
VQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGL
AKWFGSDVLQQPLPSMPAKVISVDELEYRQ
Isotype
IgG
Antibody clone number
2C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -