HPA001619

EIF4ENIF1 antibody from Atlas Antibodies
2610509L04Rik, 4E-T, Clast4, FLJ21601
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001619
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001619, RRID:AB_1078727
Product name
Anti-EIF4ENIF1
Provider product page
Atlas Antibodies - HPA001619
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FAPIPLEDHAENKVDILEMLQKAKVDLKPLLSSLS
ANKEKLKESSHSGVVLSVEEVEAGLKGLKVDQQVK
NSTPFMAEHLEETLSAVTNNRQLKKDGDMTAFNKL
VSTMKASGTLPSQPKVSRNLESHLMSPAEI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -