HPA001619

EIF4ENIF1 antibody from Sigma-Aldrich
2610509L04Rik, 4E-T, Clast4, FLJ21601
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001619
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001619, RRID:AB_1078727
Product name
Anti-EIF4ENIF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001619
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4E transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAPIPLEDHAENKVDILEMLQKAKVDLKPLLSSLS
ANKEKLKESSHSGVVLSVEEVEAGLKGLKVDQQVK
NSTPFMAEHLEETLSAVTNNRQLKKDGDMTAFNKL
VSTMKASGTLPSQPKVSRNLESHLMSPAEI
Storage
-20C
Provider Type Product Number
- No reagents -