HPA012384

SLC29A1 antibody from Sigma-Aldrich
ENT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012384
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012384, RRID:AB_1857073
Product name
Anti-SLC29A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012384
Antibody type
Polyclonal
Antigen
Equilibrative nucleoside transporter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAG
KEESGVSVSNSQPTNESHSIKAILK
Storage
-20C
Provider Type Product Number
- No reagents -