Antibody data

Product number
H00285533-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00285533-M01, RRID:AB_1137423
Product name
RNF175 monoclonal antibody (M01), clone 4E9
Provider product page
Abnova Corporation - H00285533-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RNF175.
Antigen sequence
FYSVSRLPTRSLSDNICAVCGQKIIVELDEEGLIE
NTYQLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV
DLKRMISNPWERTHFLYGQIL
Isotype
IgG
Antibody clone number
4E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -