HPA017286

STRN antibody from Sigma-Aldrich
SG2NA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017286
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017286, RRID:AB_1857618
Product name
Anti-STRN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017286
Antibody type
Polyclonal
Antigen
Striatin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RALLGFSSDVTDREDDKNQDSVVNGTEAEVKETAM
IAKSELTDSASVLDNFKFLESAAADFSDEDEDDDV
DGREKSVIDTSTIVRKKALPDSGEDRDTKEALKEF
DFLVTSEEGDNESRSAGDGTDWEKEDQC
Storage
-20C
Provider Type Product Number
- No reagents -