HPA007666

CDK20 antibody from Sigma-Aldrich
CCRK, p42
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007666
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007666, RRID:AB_10600002
Product name
Anti-CCRK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007666
Antibody type
Polyclonal
Antigen
cyclin-dependent kinase 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGT
PNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDV
SPQALDLLGQFLLYPPHQRIAASK
Storage
-20C
Provider Type Product Number
- No reagents -