HPA015599

PEPD antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015599
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015599, RRID:AB_1855192
Product name
Anti-PEPD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015599
Antibody type
Polyclonal
Antigen
Xaa-Pro dipeptidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKP
GVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQA
HLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEP
GLRSLRTARHLQPGMVLTVEPGIYFIDHLLDE
Storage
-20C
Provider Type Product Number
- No reagents -