H00084872-B01

ZC3H10 antibody from Abnova Corporation
FLJ14451, ZC3HDC10

Antibody data

Product number
H00084872-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084872-B01, RRID:AB_1139126
Product name
ZC3H10 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00084872-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZC3H10 protein.
Antigen sequence
MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGG
ASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLG
VSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGY
KKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPIC
RDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGG
GSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRR
RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENA
MLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAK
VITLSSTAPATEQTLAPTVGTVATFNHGIAQTHTT
LSSQALQPRPVSQQELVAPAGAPAAPPTNAAPPAA
PPPPPPHLTPEITPLSAALAQTIAQGMAPPPVSMA
PVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTY
PIASQSMRITAMPH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -