HPA017742

DDC antibody from Sigma-Aldrich
AADC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017742
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017742, RRID:AB_1847832
Product name
Anti-DDC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017742
Antibody type
Polyclonal
Antigen
Aromatic-L-amino-acid decarboxylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSA
SEATLVALLAARTKVIHRLQAASPELTQAAIMEKL
VAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMR
ASA
Storage
-20C
Provider Type Product Number
- No reagents -