Antibody data

Product number
H00005195-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005195-M01, RRID:AB_1137357
Product name
PEX14 monoclonal antibody (M01), clone 1G12
Provider product page
Abnova Corporation - H00005195-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PEX14.
Antigen sequence
LGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEE
DEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVE
KLRRPEGASNESE
Isotype
IgG
Antibody clone number
1G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -