HPA028222

CASZ1 antibody from Sigma-Aldrich
castor, cst, FLJ20321, SRG, ZNF693
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028222
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028222, RRID:AB_10600106
Product name
Anti-CASZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028222
Antibody type
Polyclonal
Antigen
castor zinc finger 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STMTEFLGMFGYDDQNTRDELARKISFEKLHAGST
PEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAG
EQLSWPAPSTKTEERVGKE
Storage
-20C
Provider Type Product Number
- No reagents -