HPA029927

CASZ1 antibody from MilliporeSigma / Merck KGaA
castor, cst, FLJ20321, SRG, ZNF693
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029927
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029927, RRID:AB_10601564
Product name
Anti-CASZ1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029927
Antibody type
Polyclonal
Antigen
castor zinc finger 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQ
LINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRP
GCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYK
YE
Storage
-20C
Provider Type Product Number
- No reagents -