H00023283-B01

CSTF2T antibody from Abnova Corporation
CstF-64T, DKFZp434C1013, KIAA0689, tauCstF-64

Antibody data

Product number
H00023283-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023283-B01, RRID:AB_1138121
Product name
CSTF2T MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023283-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CSTF2T protein.
Antigen sequence
MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDI
FSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETA
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLG
PAAPIIDSPYGDPIDPEDAPESITRAVASLPPEQM
FELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQA
QVVMRIMDPEIALKILHRKIHVTPLIPGKSQSVSV
SGPGPGPGPGLCPGPNVLLNQQNPPAPQPQHLARR
PVKDIPPLMQTPIQGGIPAPGPIPAAVPGAGPGSL
TPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIP
RGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVE
PRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPL
GDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMET
RAMETEVLETRVMERRGMETCAMETRGMEARGMDA
RGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQ
GPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQG
GGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPS
SFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLP
PEQRQSILILKEQIQKSTGAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -