Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001936-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001936-B01P, RRID:AB_1573381
- Product name
- EEF1D purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human EEF1D protein.
- Antigen sequence
MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAG
ASRQENGASVILRDIARARENIQKSLAGSSGPGAS
SGTSGDHGELVVRIASLEVENQSLRGVVQELQQAI
SKLEARLNVLEKSSPGHRATAPQTQHVSPMRQVEP
PAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR
EERLRQYAEKKAKKPALVAKSSILLDVKPWDDETD
MAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQI
QCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNK
I- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Unbalanced expression of the translation complex eEF1 subunits in human cardioesophageal carcinoma.
Veremieva M, Khoruzhenko A, Zaicev S, Negrutskii B, El'skaya A
European journal of clinical investigation 2011 Mar;41(3):269-76
European journal of clinical investigation 2011 Mar;41(3):269-76
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EEF1D expression in transfected 293T cell line (H00001936-T01) by EEF1D MaxPab polyclonal antibody.Lane 1: EEF1D transfected lysate(30.91 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEF1D MaxPab polyclonal antibody. Western Blot analysis of EEF1D expression in human pancreas.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEF1D MaxPab polyclonal antibody. Western Blot analysis of EEF1D expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to EEF1D on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol