Antibody data

Product number
H00219995-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00219995-B01, RRID:AB_1138635
Product name
MGC35295 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00219995-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC35295 protein.
Antigen sequence
MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAE
KNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGV
TNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAI
HAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNV
AYAQGVV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -