Antibody data

Product number
H00219995-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00219995-M03, RRID:AB_1237785
Product name
MGC35295 monoclonal antibody (M03), clone 1D4
Provider product page
Abnova Corporation - H00219995-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MGC35295.
Antigen sequence
MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAE
KNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGV
TNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAI
HAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNV
AYAQGVV
Isotype
IgG
Antibody clone number
1D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -