HPA015142

KCTD3 antibody from Sigma-Aldrich
NY-REN-45
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015142
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015142, RRID:AB_1852174
Product name
Anti-KCTD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015142
Antibody type
Polyclonal
Antigen
BTB/POZ domain-containing protein KCTD3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITPLVRRLLLCEELERSSCGSVLFHGYLPPPGIPS
RKINNTVRSADSRNGLNSTEGEARGNGTQPVLSGT
GEETVRLGFPVDPRKVLIVAGHHNWIVAAYAHFAV
CYRIKESSGWQQVFTSP
Storage
-20C
Provider Type Product Number
- No reagents -