HPA017578

ABCF1 antibody from Sigma-Aldrich
ABC50, EST123147
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017578
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017578, RRID:AB_1844438
Product name
Anti-ABCF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017578
Antibody type
Polyclonal
Antigen
ATP-binding cassette sub-family F member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPK
PRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPA
KPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKP
QNKFAAL
Storage
-20C
Provider Type Product Number
- No reagents -