HPA017578

ABCF1 antibody from Atlas Antibodies
ABC50, EST123147
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA017578
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017578, RRID:AB_1844438
Product name
Anti-ABCF1
Provider product page
Atlas Antibodies - HPA017578
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPK
PRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPA
KPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKP
QNKFAAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -