ABIN630000

antibody from antibodies-online

Targeting: SSB La, La/SSB, LARP3

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630000 - Provider product page
Provider: antibodies-online
Product name: anti-SSB antibody
Antibody type: Polyclonal
Antigen: SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids PGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEED
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SSB protein structure - ABIN630000 shown in red.