HPA017287

SSB antibody from Sigma-Aldrich
La, La/SSB, LARP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017287
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017287, RRID:AB_1852672
Product name
Anti-SSB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017287
Antibody type
Polyclonal
Antigen
Lupus La protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPL
EIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISE
DKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFP
TDATLDD
Storage
-20C
Provider Type Product Number
- No reagents -