Antibody data

Product number
ABIN405973
Provider
antibodies-online
Product name
anti-Glioblastoma Amplified Sequence (GBAS) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405973
Antibody type
Polyclonal
Antigen
The immunogen for anti-GBAS antibody: synthetic peptide directed towards the middle region of human GBAS
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
Host
Rabbit
Antigen sequence
VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFR
QDGNE AVGGFFSQIG
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -