Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405973 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glioblastoma Amplified Sequence (GBAS) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GBAS antibody: synthetic peptide directed towards the middle region of human GBAS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFR
QDGNE AVGGFFSQIG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
No validations: Submit validation data