HPA017288

STAC2 antibody from Sigma-Aldrich
24b2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017288, RRID:AB_2239827
Product name
Anti-STAC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017288
Antibody type
Polyclonal
Antigen
SH3 and cysteine-rich domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCATSKESPPTGDSGKVDPVYETLRYGTSLALMNR
SSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGP
GDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRK
DVGPMYSYVALYKFLPQENNDLALQPGDRIMLV
Storage
-20C
Provider Type Product Number
- No reagents -