Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- orb2088842 - Provider product page

- Provider
- Biorbyt
- Product name
- TMC3 Rabbit Polyclonal Antibody (HRP)
- Antibody type
- Polyclonal
- Description
- TMC3 Rabbit Polyclonal Antibody (HRP) is an HRP conjugated, affinity purified antibody. The immunogen is a synthetic peptide directed towards the following sequence YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF. This antibody is predicted to react with Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
- Host
- Rabbit
- Conjugate
- Horseradish Peroxidase
- Vial size
- 100 ul
- Storage
- All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
No comments: Submit comment
No validations: Submit validation data