HPA013602

SLC6A3 antibody from Sigma-Aldrich
DAT, DAT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013602
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013602, RRID:AB_1847484
Product name
Anti-SLC6A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013602
Antibody type
Polyclonal
Antigen
Sodium-dependent dopamine transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSS
GDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDL
G
Storage
-20C
Provider Type Product Number
- No reagents -