ABIN629969

antibody from antibodies-online

Targeting: FARS2 dJ236A3.1, FARS1, mtPheRS

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN629969 - Provider product page
Provider: antibodies-online
Product name: anti-Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2) (N-Term) antibody
Antibody type: Polyclonal
Antigen: FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

FARS2 protein structure - ABIN629969 shown in red.