Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310067 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FARS2 antibody: synthetic peptide directed towards the N terminal of human FARS2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHP
LWLIK ERVKEHFYKQ- Vial size
- 0.1 mg
Submitted references Zfp206 regulates ES cell gene expression and differentiation.
Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Zhang W, Walker E, Tamplin OJ, Rossant J, Stanford WL, Hughes TR
Nucleic acids research 2006;34(17):4780-90
Nucleic acids research 2006;34(17):4780-90
Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Brandenberger R, Wei H, Zhang S, Lei S, Murage J, Fisk GJ, Li Y, Xu C, Fang R, Guegler K, Rao MS, Mandalam R, Lebkowski J, Stanton LW
Nature biotechnology 2004 Jun;22(6):707-16
Nature biotechnology 2004 Jun;22(6):707-16
No comments: Submit comment
No validations: Submit validation data