HPA018148

FARS2 antibody from Sigma-Aldrich
dJ236A3.1, FARS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018148
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018148, RRID:AB_1848426
Product name
Anti-FARS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018148
Antibody type
Polyclonal
Antigen
Phenylalanyl-tRNA synthetase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKK
GDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVG
DVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIK
DGES
Storage
-20C
Provider Type Product Number
- No reagents -