HPA018148

FARS2 antibody from Atlas Antibodies
dJ236A3.1, FARS1, mtPheRS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018148
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018148, RRID:AB_1848426
Product name
Anti-FARS2
Provider product page
Atlas Antibodies - HPA018148
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKK
GDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVG
DVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIK
DGES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -