Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001813-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001813-M01A, RRID:AB_1204283
- Product name
- DRD2 monoclonal antibody (M01A), clone 1B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DRD2.
- Antigen sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYN
YYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTN
YLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI
HCDIF- Isotype
- IgG
- Antibody clone number
- 1B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SCH23390, a dopamine D1 receptor antagonist, suppressed scratching behavior induced by compound 48/80 in mice.
Akimoto Y, Furuse M
European journal of pharmacology 2011 Nov 16;670(1):162-7
European journal of pharmacology 2011 Nov 16;670(1):162-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DRD2 monoclonal antibody (M01A), clone 1B11 Western Blot analysis of DRD2 expression in HL-60 ( Cat # L014V1 ).