HPA015691

DRD2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015691, RRID:AB_1847834
Product name
Anti-DRD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015691
Antibody type
Polyclonal
Antigen
D(2) dopamine receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRV
EAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQL
TLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKI
FEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML
Storage
-20C
Provider Type Product Number
- No reagents -