Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015691 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DRD2
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Affinity purified using the antigen as affinity ligand.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRV
EAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQL
TLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKI
FEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML- Isotype
- IgG
- Vial size
- 110µl
- Concentration
- 0.1 mg/ml
- Storage
- For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references Disruption of A2AR-D2R Heteroreceptor Complexes After A2AR Transmembrane 5 Peptide Administration Enhances Cocaine Self-Administration in Rats
Effects of Long‐Term Alcohol Drinking on the Dopamine D2 Receptor: Gene Expression and Heteroreceptor Complexes in the Striatum in Rats
The dopamine D2receptor is expressed and sensitizes adenylyl cyclase activity in airway smooth muscle
Borroto-Escuela D, Wydra K, Li X, Rodriguez D, Carlsson J, Jastrzębska J, Filip M, Fuxe K
Molecular Neurobiology 2018;55(8):7038-7048
Molecular Neurobiology 2018;55(8):7038-7048
Effects of Long‐Term Alcohol Drinking on the Dopamine D2 Receptor: Gene Expression and Heteroreceptor Complexes in the Striatum in Rats
Feltmann K, Borroto‐Escuela D, Rüegg J, Pinton L, de Oliveira Sergio T, Narváez M, Jimenez‐Beristain A, Ekström T, Fuxe K, Steensland P
Alcoholism: Clinical and Experimental Research 2018;42(2):338-351
Alcoholism: Clinical and Experimental Research 2018;42(2):338-351
The dopamine D2receptor is expressed and sensitizes adenylyl cyclase activity in airway smooth muscle
Mizuta K, Zhang Y, Xu D, Masaki E, Panettieri R, Emala C
American Journal of Physiology-Lung Cellular and Molecular Physiology 2012;302(3):L316-L324
American Journal of Physiology-Lung Cellular and Molecular Physiology 2012;302(3):L316-L324
No comments: Submit comment
No validations: Submit validation data