HPA005757

ZWINT antibody from Sigma-Aldrich
KNTC2AP, SIP30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005757
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005757, RRID:AB_10600224
Product name
Anti-ZWINT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005757
Antibody type
Polyclonal
Antigen
ZW10 interactor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQ
RYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQ
PTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN
Storage
-20C
Provider Type Product Number
- No reagents -